TESAMORELIN RESEARCH PEPTIDE
Tesamorelin Peptide for Research & Biotechnology Projects
Signalyn Bio supplies tesamorelin peptide for research and biotechnology projects, with support for purification, lyophilization, analytical testing, packaging, and batch-specific documentation.
Project requirements can be discussed around target purity, quantity, analytical scope, vial or bulk format, custom packaging, and documentation needs.
PRODUCT SPECIFICATIONS
Tesamorelin Peptide Product Specifications
Use verified data for the actual tesamorelin batch or project being offered.
| Product Name | Tesamorelin |
| Alternative Name | TH9507 |
| CAS Number | 218949-48-5 |
| Molecular Formula | C221H366N72O67S |
| Molecular Weight | Approx. 5136 g/mol |
| Peptide Length | 44 amino acids |
| Peptide Type | Stabilized synthetic GHRH analogue |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Structure / Modification | N-terminally modified 44-residue peptide analogue |
| Product Form / Salt Form | According to batch-specific product specification |
| Grade / Specification | Research grade / project-specific specification |
| Appearance | Use verified Signalyn Bio product specification |
| Purity | Batch-specific HPLC result available with supporting analytical documentation |
| Identity | Mass spectrometry, according to batch testing scope |
| Analytical Methods | HPLC / Mass Spectrometry |
| Format | Lyophilized or project-specific format |
| Packaging | Vial / multi-vial box / bulk / custom packaging |
| Storage | According to Signalyn Bio product specification and batch documentation |
| Documentation | COA / HPLC / MS / batch identification, according to batch |
| Intended Use | For research use only |
MANUFACTURING & PROJECT SUPPORT
Tesamorelin Manufacturing & Project Support
Peptide Purification
Purity requirements can be reviewed according to peptide characteristics, project scope, analytical needs, and downstream processing.
Peptide Lyophilization
Tesamorelin material can be prepared in lyophilized format according to project, handling, storage, and packaging requirements.
Packaging & Custom Labels
Vial format, cartons, multi-vial packaging, custom labels, batch fields, and branded packaging can be discussed according to project needs.
ANALYTICAL DATA & QUALITY EVIDENCE
Tesamorelin Peptide Analytical Data & Batch Documentation
HPLC Analysis
Supports chromatographic purity assessment, impurity-profile review, and batch-level analytical evaluation.
Mass Spectrometry
Supports molecular identity verification and complementary analytical characterization of tesamorelin material.
Certificate of Analysis
Batch-specific documentation can summarize purity information, identity results, sample identification, and other available quality data.
PACKAGING & SUPPLY OPTIONS
Tesamorelin Peptide Packaging & Supply Options
Vial Packaging
Project-specific vial formats can be discussed according to quantity, handling, storage, and delivery requirements.
Bulk Supply
Larger-volume tesamorelin requirements can be reviewed through the bulk peptide manufacturing workflow.
Custom Labels & Packaging
Custom labels, cartons, batch fields, branded packaging, and multi-vial configurations can be discussed according to project requirements.
TESAMORELIN FAQ
Frequently Asked Questions About Tesamorelin Peptide Supply
What tesamorelin specifications are available?
Available specifications can vary by batch and project. Request current purity, format, quantity, analytical documentation, and packaging information for the batch being discussed.
What analytical documentation is available?
Depending on the batch and testing scope, available records may include HPLC data, mass spectrometry data, Certificate of Analysis information, and batch identification documentation.
Can packaging and labels be customized?
Yes. Vial format, cartons, labels, batch fields, branded packaging, and documentation requirements can be discussed on a project-specific basis.
REQUEST TESAMORELIN INFORMATION
Discuss Your Tesamorelin Project Requirements
Share target purity, quantity, analytical testing, packaging, labeling, documentation, and delivery requirements with our team.